PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA16G00066
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 243aa    MW: 27802.2 Da    PI: 9.1239
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA16G00066genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.9e-181158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed llv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
       AA16G00066 11 KGPWTEQEDTLLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 58
                     79********************************************97 PP

2Myb_DNA-binding54.42.9e-1764109148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
       AA16G00066  64 RGKMTSQEEALVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 109
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.644658IPR017930Myb domain
SuperFamilySSF466891.39E-2910105IPR009057Homeodomain-like
SMARTSM007173.8E-161060IPR001005SANT/Myb domain
PfamPF002496.3E-171158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-211265IPR009057Homeodomain-like
CDDcd001678.49E-121358No hitNo description
PROSITE profilePS5129426.75959113IPR017930Myb domain
SMARTSM007172.3E-1663111IPR001005SANT/Myb domain
PfamPF002492.5E-1564108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2366112IPR009057Homeodomain-like
CDDcd001672.04E-1166109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MMKRVGEENR KGPWTEQEDT LLVNFVHLFG DRRWDFIAKV SGLNRTGKSC RLRWVNYLHP  60
GLKRGKMTSQ EEALVLELHA KWGNRWSKIA RKLPGRTDNE IKNYWRTHMR KKAQEKKKPE  120
SPTSSLSNCC SSSVSIANTS GNESFYDTGG SAGKINQEIK DGYSMDDIWK EIDHSASNII  180
TPVRDFYLEQ SFPPLDSPSW ESSLDSIWNT DAGKSKMMYS SFAIDQFPFC FKHGTSPWSS  240
DAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-28111134105MYB PROTO-ONCOGENE PROTEIN
1msf_C5e-28111134105C-Myb DNA-Binding Domain
1mse_C5e-28111134105C-Myb DNA-Binding Domain
1h89_C2e-271111358159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-271111358159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010503226.11e-127PREDICTED: transcription factor MYB48-like isoform X2
SwissprotQ9LX821e-125MYB48_ARATH; Transcription factor MYB48
TrEMBLD7LMV91e-126D7LMV9_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_50010971e-126(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.11e-123myb domain protein 48